The rna helicase database
WebbRNA helicases are involved in the mediation of antiviral immune response because they can identify foreign RNAs in vertebrates. About 80% of all viruses are RNA viruses and they contain their own RNA helicases. … WebbThe database provides ready access to sequence, structure, biochemical and cellular function of all RNA helicases from the most widely used model organisms Escherichia …
The rna helicase database
Did you know?
WebbBasic information and list of all helicases was obtained from the Human Genome Organization (HUGO) portal, 37 and 112 helicases mainly include DNA helicase and RNA helicase. In order to observe the genetic variation of helicase molecules in cancer, we showed somatic mutations of 10 molecules with the highest mutation frequency in … Webb7 rader · 1 jan. 2010 · RNA helicases are ubiquitous and essential enzymes that function in nearly all aspects of RNA ...
Webb4 jan. 2011 · RNA helicases are ubiquitous and essential enzymes that function in nearly all aspects of RNA metabolism. The RNA helicase database (www.rnahelicase.org) … Webb3 dec. 2024 · RNAcentral is a free, public resource that offers integrated access to a comprehensive and up-to-date set of non-coding RNA sequences provided by a …
WebbRNA helicase database. Contact; Research center: Case Western Reserve University: Laboratory: Department of Biochemistry, Center for RNA Molecular Biology: Authors: … Webb13 juni 2024 · The RNA helicases are an important class of enzymes which are known to influence almost every aspect of RNA metabolism. The majority of RNA helicases belong to the SF2 (superfamily 2)...
Webb4 aug. 2024 · Using a curated RiBi gene signature (table S1D) and RNA sequencing (RNA-seq) data from the DepMap consortium, we then categorized all cell lines into low and high RiBi (fig. S1F) and found that eIF4A3 expression is higher in cell lines with high RiBi (Fig. 1D), further supporting a role of the helicase in this process.
Webb30 nov. 2010 · Component of a multi-helicase-TICAM1 complex that acts as a cytoplasmic sensor of viral double-stranded RNA (dsRNA) and plays a role in the activation of a cascade of antiviral responses including the induction of pro-inflammatory cytokines via the adapter molecule TICAM1 ( By similarity ). sleeper civic hatchWebb25 nov. 2010 · RNA helicases are ubiquitous and essential enzymes that function in nearly all aspects of RNA metabolism. The RNA helicase database (www.rnahelicase.org) … sleeper class booking timeWebbProtein family/group databases TCDB 3.A.18.1.1 the nuclear mrna exporter (mrna-e) family Names & Taxonomy Protein names Recommended name Spliceosome RNA helicase DDX39B Curated EC number EC:3.6.4.13 ( UniProtKB ENZYME Rhea) 1 publication Alternative names 56 kDa U2AF65-associated protein ATP-dependent RNA helicase p47 … sleeper class layoutWebb3 dec. 2024 · 2024-04-03. The following are RNA databases freely accessible online. miRBase database: a searchable database of published miRNA sequences and annotation. miRDB is an online database for miRNA target prediction and functional annotations. Rfam database is an annotated, open access database that contains information about non … sleeper classWebb19 okt. 2024 · The findings suggest that the DEAD-box RNA helicase encoded by the lmo0866 homolog is critical for relative fitness of L. monocytogenes on cantaloupe. … sleeper class tatkal booking time onlineWebb12 apr. 2024 · A long noncoding RNA, named CCDSTlnc (cervical cancer DExH-box helicase 9 suppressive transcript), is significantly downregulated in cervical cancer tissues, and binds to upregulated pro-oncogenic DHX9 (DExH-Box Helicase 9) protein, promoter of motility, and angiogenesis (X. Ding et al., 2024). sleeper class seatingWebbgroup alignment q9h2u1 dhx36_hs. msydyhqnwgrdggprssgggygggpagghggnrgsggggggggggrggrgrhpghlkgr b2rqs6 dhx36_mm. msydyhqswsrdggprgsg----qgssgggggsrgsggg ... sleeper class tatkal timings